Loading...
Statistics
DJ Reflex & The Wizard
www.help55.com/
Disc Jockey homepage
Help55.com
Help55.com is hosted in
United States
/
Indianapolis
.
Help55.com uses HTTPS protocol.
Number of used technologies:
1.
First technologies:
Html,
Number of used javascripts: 0.
Number of used analytics tools:
0.
Its server type is:
LiteSpeed.
Technologies in use by Help55.com
Technology
Number of occurences: 1
- Html
Advertisement
Server Type
- LiteSpeed
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Not founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Help55.com
SSL certificate
- name: /CN=owncloud.spencersmith.co.uk/ST=Cornwall/O=Maverick Ventures UK Ltd/C=GB/emailAddress=info@maverickventures.co.uk/L=Hayle
- subject:
- CN: owncloud.spencersmith.co.uk
- ST: Cornwall
- O: Maverick Ventures UK Ltd
- C: GB
- emailAddress: info@maverickventures.co.uk
- L: Hayle
- hash: 1b7cbfd6
- issuer:
- CN: owncloud.spencersmith.co.uk
- ST: Cornwall
- O: Maverick Ventures UK Ltd
- C: GB
- emailAddress: info@maverickventures.co.uk
- L: Hayle
- version: 2
- serialNumber: 911801529
- validFrom: 150214005742Z
- validTo: 160214005742Z
- validFrom_time_t: 1423875462
- validTo_time_t: 1455411462
- extensions:
- subjectKeyIdentifier: D4:FB:42:37:14:E2:6E:9A:0E:74:23:F8:1B:EC:F8:B6:E7:DA:78:08
- authorityKeyIdentifier: keyid:D4:FB:42:37:14:E2:6E:9A:0E:74:23:F8:1B:EC:F8:B6:E7:DA:78:08
- basicConstraints: CA:TRUE
Number of occurences: 4
- Name:
Content: en-us - Name: keywords
Content: JD, Disc Jockey, Music, Bars - Name: description
Content: Disc Jockey homepage - Name: Robots
Content: index,follow
Server / Hosting
- IP: 198.134.107.226
- Latitude: 39.77
- Longitude: -86.16
- Country: United States
- City: Indianapolis
Rname
- ns2.wwwroot.net
- ns1.wwwroot.net
- help55.com
Target
- zones.wwwroot.net
HTTP Header Response
HTTP/1.1 200 OK
Last-Modified: Tue, 19 Oct 2010 15:34:07 GMT
Content-Type: text/html
Content-Length: 1671
Date: Sat, 23 Jul 2016 19:30:52 GMT
Accept-Ranges: bytes
Server: LiteSpeed
X-Cache: MISS from s_sr109
X-Cache-Lookup: MISS from s_sr109:80
Via: 1.1 s_sr109 (squid/3.5.14)
Connection: keep-alive
DNS
host: help55.com
- class: IN
- ttl: 14400
- type: A
- ip: 198.134.107.226
host: help55.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.wwwroot.net
host: help55.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1.wwwroot.net
host: help55.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.wwwroot.net
- rname: zones.wwwroot.net
- serial: 2015010202
- refresh: 14400
- retry: 7200
- expire: 314400000
- minimum-ttl: 14400
host: help55.com
- class: IN
- ttl: 14400
- type: MX
- pri: 0
- target: help55.com
host: help55.com
- class: IN
- ttl: 14400
- type: TXT
- txt: v=spf1 +a +mx +ip4:206.212.253.74 ?all
- entries: Array
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.elp55.com, www.heelp55.com, www.eelp55.com, www.hdelp55.com, www.delp55.com, www.hcelp55.com, www.celp55.com, www.huelp55.com, www.uelp55.com, www.hjelp55.com, www.jelp55.com, www.help55.com, www.elp55.com, www.hbelp55.com, www.belp55.com, www.hgelp55.com, www.gelp55.com, www.hlp55.com, www.hexlp55.com, www.hxlp55.com, www.heslp55.com, www.hslp55.com, www.hewlp55.com, www.hwlp55.com, www.herlp55.com, www.hrlp55.com, www.heflp55.com, www.hflp55.com, www.hevlp55.com, www.hvlp55.com, www.heclp55.com, www.hclp55.com, www.heqlp55.com, www.hqlp55.com, www.healp55.com, www.halp55.com, www.heylp55.com, www.hylp55.com, www.hep55.com, www.helup55.com, www.heup55.com, www.hel8p55.com, www.he8p55.com, www.hel9p55.com, www.he9p55.com, www.heljp55.com, www.hejp55.com, www.hel0p55.com, www.he0p55.com, www.helmp55.com, www.hemp55.com, www.helpp55.com, www.hepp55.com, www.helop55.com, www.heop55.com, www.hel55.com, www.helpi55.com, www.heli55.com, www.helpk55.com, www.helk55.com, www.helpu55.com, www.helu55.com, www.helpj55.com, www.helj55.com, www.helpl55.com, www.hell55.com, www.help5.com, www.help5e5.com, www.helpe5.com, www.help5r5.com, www.helpr5.com, www.help525.com, www.help25.com, www.help5t5.com, www.helpt5.com, www.help535.com, www.help35.com, www.help5.com, www.help55e.com, www.help5e.com, www.help55r.com, www.help5r.com, www.help552.com, www.help52.com, www.help55t.com, www.help5t.com, www.help553.com, www.help53.com,
Other websites we recently analyzed
- HostingDiscounter De goedkoopste webhoster van nederland
HostingDiscounter De goedkoopste webhoster van Nederland - Goedkope domeinnaam registratie, Domein hosting met veel diskspace op uw shared of dedicated serverNetherlands - 77.95.252.42
Server software: Apache/2.2.22 (Ubuntu)
Technology: Html, Javascript
Number of Javascript: 1
Number of meta tags: 5 - Home | Hoveniersbedrijf Slaats | Hovenier, Deurne, Fred Slaats
Hoveniersbedrijf uit Neerkant bij Deurne, werkzaam in de gehele regio van Noord-Brabant en Limburg. Onze specialiteit is onderhoud en snoeiwerk.Netherlands - 149.210.237.177
Server software: Apache
Technology: AJAX Libraries API, CSS, Html, Javascript, Add This
Number of Javascript: 2
Number of meta tags: 2 - Welcome to Gehlin.Com!
Sweden - 213.180.93.13
Server software: Apache/2.2.22 (Ubuntu)
Technology: CSS, Html
Number of meta tags: 1 - tampacriminaldefenselawyer.net
Wayne (United States) - 216.250.120.114
Server software: Apache
Technology: Html
Number of meta tags: 1 - 267286.com
China - 203.195.130.175
Server software: Microsoft-IIS/7.5
Technology: CSS, Html, Html5, Iframe, Javascript
Number of meta tags: 1 - Exotic Beads Manufacturer Penang, Georgetown, Ethnic Beads Supplier Malaysia ~ Guo Qiang Sdn Bhd (beadsZONE)
Guo Qiang Sdn Bhd (beadsZONE) is the largest manufacturer and supplier of ethnic & exotic beads accessories and jewellery in Penang, Malaysia.Malaysia - 119.110.102.139
G Analytics ID: UA-37858188-33
Server software: Apache
Technology: CSS, Font Awesome, Html, Javascript, jQuery UI, Php, Google Analytics, Facebook Box
Number of Javascript: 6
Number of meta tags: 9 - Concern Organization
Concern Organization is a nongovernmental, nonprofit and nonpolitical organization based in Faisalabad in the province of Punjab – Pakistan. We mainly workHouston (United States) - 192.185.46.37
Server software: nginx/1.10.1
Technology: CSS, Fancybox, Flexslider, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Lightbox, Php, Pingback, Shortcodes, SuperFish, Wordpress
Number of Javascript: 22
Number of meta tags: 4 - Le Moulin du Vey
Location de gîtes en Normandie, de chambres d'hôtes en Normandie, Location de salle de Réception en Normandie, au coeur de la Suisse-Normande à Clécy.Mountain View (United States) - 74.125.140.121
Server software: Varnish
Technology: CSS, Html, Iframe, Javascript, Php
Number of Javascript: 1
Number of meta tags: 3 - The MAV Agency: Social Media Management
The MAV Agency brings a new perspective to social media management by focusing on engagement and building a community among your followers.Ashburn (United States) - 54.83.179.144
Server software: Pepyaka/1.9.13
Technology: CSS, Html, Html5, Javascript, Wix
Number of Javascript: 2
Number of meta tags: 7 - jadhav.com
Road Town (Virgin Islands, British) - 208.91.197.127
Server software: Apache
Technology: Html
Number of meta tags: 2